PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART05G26980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ZF-HD
Protein Properties Length: 92aa    MW: 9474.4 Da    PI: 7.0118
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART05G26980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.71e-312983258
      ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                     ++vrY+eCl+NhAa++Ggh+vDGCgEfmp +g+   a+alkCaACgCHR+FHR++  
  OBART05G26980.1 29 AEVRYHECLRNHAAAMGGHVVDGCGEFMPMPGDA--ADALKCAACGCHRSFHRKDDG 83
                     579***************************8876..9*****************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-233181IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.2E-273181IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.5E-273281IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.2573381IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MGVAYGRTPP SSSSSPAASA SAGNGAGAAE VRYHECLRNH AAAMGGHVVD GCGEFMPMPG  60
DAADALKCAA CGCHRSFHRK DDGQQQQQQQ QQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126131e-146CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639557.14e-57PREDICTED: zinc-finger homeodomain protein 6
SwissprotB8AX536e-60ZHD6_ORYSI; Zinc-finger homeodomain protein 6
TrEMBLA0A0D3GB831e-61A0A0D3GB83_9ORYZ; Uncharacterized protein
STRINGBGIOSGA020427-PA1e-57(Oryza sativa Indica Group)
STRINGORGLA05G0234100.12e-57(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-20homeobox protein 31